Cell senescence gene database Home
Cell senescence database
General information | Literature | Expression | Regulation | Mutation | Homolog | Interaction

Basic Information

Gene ID

4914

Name

NTRK1

Synonym

MTC|TRK|TRK1|TRKA|Trk-A|p140-TrkA;neurotrophic tyrosine kinase, receptor, type 1;NTRK1;neurotrophic tyrosine kinase, receptor, type 1

Definition

Oncogene TRK|TRK1-transforming tyrosine kinase protein|gp140trk|high affinity nerve growth factor receptor|tropomyosin-related kinase A|tyrosine kinase receptor A

Position

1q21-q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

ARMS-mediated activation;PID Reactome;500631

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

Retrograde neurotrophin signalling;PID Reactome;500645

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Signalling to RAS;PID Reactome;500626

Pathway

Signalling to STAT3;PID Reactome;500643

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

PLC-gamma1 signalling;PID Reactome;500632

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

Signalling to ERKs;PID Reactome;500625

Pathway

NGF signalling via TRKA from the plasma membrane;PID Reactome;500621

Pathway

PI3K/AKT signalling;PID Reactome;500639

Pathway

TRKA activation by NGF;PID Reactome;500623

Pathway

role of erk5 in neuronal survival pathway;PID BioCarta;100171

Pathway

trka receptor signaling pathway;PID BioCarta;100011

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Signalling to p38 via RIT and RIN;PID Reactome;500628

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Disease

Cancers of the nervous system;KEGG DISEASE

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

Cancers;KEGG DISEASE

Disease

Insensitivity to pain, congenital, with anhidrosis;OMIM

Disease

Medullary thyroid carcinoma, familial;OMIM

Disease

Neuroblastoma;KEGG DISEASE;H00043

Disease

Cancers of endocrine organs;KEGG DISEASE

Disease

CANCER;GAD

Disease

neuroblastoma;GAD

External Links

Links to Entrez Gene

4914

Links to all GeneRIF Items

4914

Links to iHOP

4914

Sequence Information

Nucleotide Sequence

>4914 : length: 2663
TGCAGCTGGGAGCGCACAGACGGCTGCCCCGCCTGAGCGAGGCGGGCGCCGCCGCGATGC
TGCGAGGCGGACGGCGCGGGCAGCTTGGCTGGCACAGCTGGGCTGCGGGGCCGGGCAGCC
TGCTGGCTTGGCTGATACTGGCATCTGCGGGCGCCGCACCCTGCCCCGATGCCTGCTGCC
CCCACGGCTCCTCGGGACTGCGATGCACCCGGGATGGGGCCCTGGATAGCCTCCACCACC
TGCCCGGCGCAGAGAACCTGACTGAGCTCTACATCGAGAACCAGCAGCATCTGCAGCATC
TGGAGCTCCGTGATCTGAGGGGCCTGGGGGAGCTGAGAAACCTCACCATCGTGAAGAGTG
GTCTCCGTTTCGTGGCGCCAGATGCCTTCCATTTCACTCCTCGGCTCAGTCGCCTGAATC
TCTCCTTCAACGCTCTGGAGTCTCTCTCCTGGAAAACTGTGCAGGGCCTCTCCTTACAGG
AACTGGTCCTGTCGGGGAACCCTCTGCACTGTTCTTGTGCCCTGCGCTGGCTACAGCGCT
GGGAGGAGGAGGGACTGGGCGGAGTGCCTGAACAGAAGCTGCAGTGTCATGGGCAAGGGC
CCCTGGCCCACATGCCCAATGCCAGCTGTGGTGTGCCCACGCTGAAGGTCCAGGTGCCCA
ATGCCTCGGTGGATGTGGGGGACGACGTGCTGCTGCGGTGCCAGGTGGAGGGGCGGGGCC
TGGAGCAGGCCGGCTGGATCCTCACAGAGCTGGAGCAGTCAGCCACGGTGATGAAATCTG
GGGGTCTGCCATCCCTGGGGCTGACCCTGGCCAATGTCACCAGTGACCTCAACAGGAAGA
ACGTGACGTGCTGGGCAGAGAACGATGTGGGCCGGGCAGAGGTCTCTGTTCAGGTCAACG
TCTCCTTCCCGGCCAGTGTGCAGCTGCACACGGCGGTGGAGATGCACCACTGGTGCATCC
CCTTCTCTGTGGATGGGCAGCCGGCACCGTCTCTGCGCTGGCTCTTCAATGGCTCCGTGC
TCAATGAGACCAGCTTCATCTTCACTGAGTTCCTGGAGCCGGCAGCCAATGAGACCGTGC
GGCACGGGTGTCTGCGCCTCAACCAGCCCACCCACGTCAACAACGGCAACTACACGCTGC
TGGCTGCCAACCCCTTCGGCCAGGCCTCCGCCTCCATCATGGCTGCCTTCATGGACAACC
CTTTCGAGTTCAACCCCGAGGACCCCATCCCTGTCTCCTTCTCGCCGGTGGACACTAACA
GCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTG
TGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAAT
GTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGC
TGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCA
AAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTG
TTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTG
GGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGG
CTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTG
AGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGG
GCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCC
GATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCC
TGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGG
CGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGAC
TGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACC
GTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACC
GTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCA
CCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGC
AGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGG
GCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGC
AAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAG
GGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCCCCATAGCTCCCA
GCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGT
GGGGGCTGGGAGTAGAGGATGTTCCTGCTTCTCTAGGCAAGGTCCCGTCATAGCAATTAT
ATTTATTATCCCTTGAAAAAAAA

Protein Sequence

>4914 : length: 796
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG



')